PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g021230.1
Common NameMTR_1g021230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 445aa    MW: 50317.7 Da    PI: 5.1342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g021230.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-1659106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ede+lv  v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Medtr1g021230.1  59 KGPWTAAEDEILVAHVQKYGEGNWNSVRKCTGLARCGKSCRLRWANHL 106
                      79******************************************9986 PP

2Myb_DNA-binding46.11.1e-14112155146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ T+eE+ +++++++++G++ W+  a+ ++ gRt++++k++w++
  Medtr1g021230.1 112 KGAITAEEERRIIELHHKMGNK-WAQMAALLP-GRTDNEIKNFWNT 155
                      6888******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.35854110IPR017930Myb domain
SuperFamilySSF466891.98E-3056153IPR009057Homeodomain-like
SMARTSM007179.3E-1458108IPR001005SANT/Myb domain
PfamPF002492.7E-1459106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2260113IPR009057Homeodomain-like
CDDcd001671.60E-1161106No hitNo description
SMARTSM007174.1E-14111159IPR001005SANT/Myb domain
PROSITE profilePS5129416.616111161IPR017930Myb domain
PfamPF002491.7E-13112155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-24114160IPR009057Homeodomain-like
CDDcd001672.69E-10116155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MNSALSEDDG DHKTGILSGM SSPSSGDDDR KRQSILSADQ ETDEGDTTGG EGGEGGLKKG  60
PWTAAEDEIL VAHVQKYGEG NWNSVRKCTG LARCGKSCRL RWANHLRPDL RKGAITAEEE  120
RRIIELHHKM GNKWAQMAAL LPGRTDNEIK NFWNTRCKKR GRANLPIYPE DLSSECLLNQ  180
ENADMLTNEA SQHDEAENKV PEVIFKDYKL RPDILPPCFD KLLAGLLLRP SKRPWKSDMN  240
LYSYSNNAAA PAAFDQLRKY PMPSPSSPPW EDINEPHSYN QFNEYDNPMV GIHMAPKTSS  300
FEPIYGFMKT EPPSLQYSQT QHRSYMIPYP QVEPVQSVPT SLERSHFLPS NEANLSTQWD  360
ESDDQYDGLF PSFDYNNNNH MNTCSTDGHH SAETTQGHDI INHAAFNQIP DYFSSERDDL  420
RRKIFAHPDA APVVDDFAWY YKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-295716025127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1484040.0AC148404.7 Medicago truncatula clone mth2-28d4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589262.10.0myb transcription factor
TrEMBLG7I4J60.0G7I4J6_MEDTR; Myb transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.17e-55myb domain protein 33
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]